Product Information Sheet
Product: Rabbit anti-HA2 CD domain (Influenza virus H1 subtype) polyclonal IgG antibody.
Catalog#: 182401.
Description: This polyclonal IgG antibody was generated in rabbits with the consensus HA2 CD sequence of influenza virus H1 subtype [IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLY EKVRSQLKNN] fused to a natural nanoparticle protein carrier of E. Coli (Ref 1). The CD, also known as long alpha helix (LAH), is a major part of the HA2 subunit of HA molecule and constitutes the central part of HA stem (Ref 2 and see Figure). The IgG antibody was purified from immune serum with protein A column.
Host species: Rabbit.
Specificity: HA2 of influenza H1 subtype. It has no or a very low level of cross reaction with HA2 of H3 subtype or B virus. The reaction of this antibody with HA increases drastically when HA is exposed to low pH as the result of increased exposure of HA2 or CD domain (Ref 3).
Amount: 100 µg IgG in 100 µl PBS containing 0.05% sodium azide as the preservative.
Storage: 2-8°C for routine use and -20°C for long-term storage.
Applications:
ELISA – quality tested with recombinant HA (H1N1) antigens with a titer ≥1:100,000.
Immunoblot – quality tested with inactivated influenza antigens (see Figure).
HA acid sensitivity by ELISA - quality tested with low pH-treated inactivated influenza antigens (Ref 3).
References:
1) Ni Y, Guo J, Turner D, Tizard I. Development of a novel dual-domain nanoparticle antigen construct for universal influenza vaccine. Vaccine. 2017 Dec 15;35:7026-7032.
2) Bullough PA, Hughson FM, Skehel JJ, Wiley DC. Structure of influenza haemagglutinin at the pH of membrane fusion. Nature. 1994 Sep 1;371:37-43.
3) Ni Y, Guo J, Turner D, Tizard I. An Improved Inactivated Influenza Vaccine with Enhanced Cross Protection. Front Immunol. 2018 Aug 9;9:1815.
Notes:
For research use only and not for use in human subjects. All products are sold under the Terms and Conditions.
Product: Rabbit anti-HA2 CD domain (Influenza virus H1 subtype) polyclonal IgG antibody.
Catalog#: 182401.
Description: This polyclonal IgG antibody was generated in rabbits with the consensus HA2 CD sequence of influenza virus H1 subtype [IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLY EKVRSQLKNN] fused to a natural nanoparticle protein carrier of E. Coli (Ref 1). The CD, also known as long alpha helix (LAH), is a major part of the HA2 subunit of HA molecule and constitutes the central part of HA stem (Ref 2 and see Figure). The IgG antibody was purified from immune serum with protein A column.
Host species: Rabbit.
Specificity: HA2 of influenza H1 subtype. It has no or a very low level of cross reaction with HA2 of H3 subtype or B virus. The reaction of this antibody with HA increases drastically when HA is exposed to low pH as the result of increased exposure of HA2 or CD domain (Ref 3).
Amount: 100 µg IgG in 100 µl PBS containing 0.05% sodium azide as the preservative.
Storage: 2-8°C for routine use and -20°C for long-term storage.
Applications:
ELISA – quality tested with recombinant HA (H1N1) antigens with a titer ≥1:100,000.
Immunoblot – quality tested with inactivated influenza antigens (see Figure).
HA acid sensitivity by ELISA - quality tested with low pH-treated inactivated influenza antigens (Ref 3).
References:
1) Ni Y, Guo J, Turner D, Tizard I. Development of a novel dual-domain nanoparticle antigen construct for universal influenza vaccine. Vaccine. 2017 Dec 15;35:7026-7032.
2) Bullough PA, Hughson FM, Skehel JJ, Wiley DC. Structure of influenza haemagglutinin at the pH of membrane fusion. Nature. 1994 Sep 1;371:37-43.
3) Ni Y, Guo J, Turner D, Tizard I. An Improved Inactivated Influenza Vaccine with Enhanced Cross Protection. Front Immunol. 2018 Aug 9;9:1815.
Notes:
For research use only and not for use in human subjects. All products are sold under the Terms and Conditions.